PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G2433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 297aa    MW: 33741.8 Da    PI: 6.7612
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G2433genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++++G+g +W + +++ g++R++k+c++rw++yl
      Gh_D13G2433 14 KGPWSPEEDSKLKDYIEKYGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.52.6e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T +Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
      Gh_D13G2433  69 GEFTDDEDRIICTLFASIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.442962IPR017930Myb domain
SuperFamilySSF466891.68E-2711109IPR009057Homeodomain-like
SMARTSM007178.2E-131364IPR001005SANT/Myb domain
PfamPF002499.6E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-251569IPR009057Homeodomain-like
CDDcd001671.23E-91662No hitNo description
PROSITE profilePS5129422.21163117IPR017930Myb domain
SMARTSM007176.6E-1267115IPR001005SANT/Myb domain
PfamPF002496.1E-1169111IPR001005SANT/Myb domain
CDDcd001672.67E-870113No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDSKLKDYIE KYGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FTDDEDRIIC TLFASIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMAM  120
NGIPSQPQRK PPPPPPPFSH QPQPVSSLYE DSTAYYYTPF EPIMSSAQSD LLNNTNLTNN  180
SSLIQTPESL FSHMQYHPMR DDFLMFGGEP SCSSSDGSYG KEMKQEDHMG FRGFGASLDY  240
GTNNGVNQWI EKQSGHSGEC PLDYNPEDVK RLISSNNNCF FIDENDTQDK AMYCYYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527210.0KM052721.1 Gossypium hirsutum RAX-like transcription factor RAX2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461896.10.0PREDICTED: transcription factor RAX2-like
TrEMBLA0A0D2U7R10.0A0A0D2U7R1_G
STRINGPOPTR_0004s22490.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-77myb domain protein 36